No Security Risks Detected
This domain appears to be safe and secure
Disclaimer: This assessment is based on automated analysis of publicly available information. Results are for informational purposes only. For critical applications, consult security professionals.
Scan Information
Refresh page after 10 minutes
for updated results
Page Information
Host Information
Technologies
SSL Certificate
Performance Statistics
HTTP Headers
Technology Stack Analysis
Squarespace Commerce
Squarespace Commerce is an ecommerce platform designed to facilitate the creation of websites and online stores, with domain registration and web hosting included.
Squarespace
Squarespace provides Software-as-a-Service (SaaS) for website building and hosting, and allows users to use pre-built website templates.
HSTS
HTTP Strict Transport Security (HSTS) informs browsers that the site should only be accessed using HTTPS.
Website Cookies 1
crumb
flipcardsandmatchimagesprivacypolicy.com
External Links 1
Untitled Link
www.squarespace.com